| request information: |
|
| Catalog Code: | H00023028-M04 |
| Product Name: | AOF2 Antibody |
| Product Description: | Mouse Monoclonal anti-AOF2 (2E7) |
| Clone: | 2E7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23028 |
| Gene Symbol: | AOF2 |
| Omim ID: | 609132, |
| Immunogen: | AOF2 (NP_055828, 753 a.a. ~ 852 a.a) partial recombinant protein with GST tag. |
| Epitope: | ADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLG
AMYTLPRQATPGVPAQQSPS* |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternate splicing has been observed; however, not all transcript variants have been fully characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | protein A purified |
| Host Name: | Mouse |
| Buffer: | 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-BHC110 antibody, anti-KIAA0601 antibody, anti-LSD1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
| Product References: | Chen W, Yoshizato K. et al. Characterization of histone lysine-specific demethylase in relation to thyroid hormone-regulated anuran metamorphosis. Dev Growth Differ. 2007 May;49(4):325-34. |
order or
more information: | company product webpage |