| request information: |
|
| Catalog Code: | H00023028-A01 |
| Product Name: | AOF2 Antibody |
| Product Description: | Mouse Polyclonal anti-AOF2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 23028 |
| Gene Symbol: | AOF2 |
| Omim ID: | 609132, |
| Immunogen: | AOF2 (NP_055828, 753 a.a. ~ 852 a.a) partial recombinant protein with GST tag. |
| Epitope: | ADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLG
AMYTLPRQATPGVPAQQSPS* |
| Specificity: | AOF2 - amine oxidase (flavin containing) domain 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternate splicing has been observed; however, not all transcript variants have been fully characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-BHC110 antibody, anti-KIAA0601 antibody, anti-LSD1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |