ExactAntigen

Mouse Monoclonal anti-RAB21 (1F6) | Novus Biologicals antibody product information
CatalogCode:H00023011-M01
ProductName:RAB21 Antibody
Product Description:Mouse Monoclonal anti-RAB21 (1F6)
Clone:1F6
Clonality:Monoclonal
Immunogen:RAB21 (NP_055814, 116 a.a. ~ 226 a.a) partial recombinant protein with GST tag.
Epitope:ELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG* ...
Specificity:RAB21 - RAB21, member RAS oncogene family
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB, IHC-P
SpeciesSummary:Hu
ALTnames:anti-KIAA0118 antibody
ProteinTarget:RAB21 - RAB21, member RAS oncogene family
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:23011
Gene_Symbol:RAB21
order or
more information
:
company product webpage
request information:
Also see:
all human RAB21 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about