| request information: |
|
| Catalog Code: | H00023002-M05 |
| Product Name: | DAAM1 Antibody |
| Product Description: | Mouse Monoclonal anti-DAAM1 (5D3) |
| Clone: | 5D3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 23002 |
| Gene Symbol: | DAAM1 |
| Omim ID: | 606626, |
| Immunogen: | DAAM1 (NP_055807, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTME PALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQ IYCSKKKDQEENKGATSWPEFYIDQL* |
| Specificity: | DAAM1 - dishevelled associated activator of morphogenesis 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate, transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Localization: | Cytoplasmic. Note=Perinuclear. |
| Background: | Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DAAM 1 antibody, anti-Dishevelled associated activator of morphogenesis 1 antibody, anti-FLJ41657 antibody, anti-KIAA0666 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
| Product References: | Kida YS, Ogura T et al.. Daam1 regulates the endocytosis of EphB during the convergent extension of the zebrafish notochord. Proc Natl Acad Sci U S A. 2007 Apr 17;104(16):6708-13. Epub 2007 Apr 5. |
order or
more information: | company product webpage |