| request information: |
|
| Catalog Code: | H00022984-M01 |
| Product Name: | PDCD11 Antibody |
| Product Description: | Mouse Monoclonal anti-PDCD11 (3E12) |
| Clone: | 3E12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 22984 |
| Gene Symbol: | PDCD11 |
| Immunogen: | PDCD11 (AAH49838, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MANLEESFPRGGTRKIHKPEKAFQQSVEQDNLFDISTEEGSTKRKKSQKGPAKTKKLKIEKRESSKSAREKFEILSVES
LCEGMRILGCVKEVNELELVISLPNGLQGFV |
| Specificity: | PDCD11 - programmed cell death 11 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-ALG-4 antibody, anti-KIAA0185 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |