| request information: |
|
| Catalog Code: | H00022978-M11 |
| Product Name: | NT5C2 Antibody |
| Product Description: | Mouse Monoclonal anti-NT5C2 (2D4) |
| Clone: | 2D4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 22978 |
| Gene Symbol: | NT5C2 |
| Omim ID: | 600417, |
| Immunogen: | NT5C2 (AAH01595, 1 a.a. ~ 562 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGFELTVERLVS
IGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFN
LPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENLEKYVVKDGKLPLLLS
RMKEVGKVFLATNSDYKY |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | Purine 5-prime-nucleotidase (EC 3.1.3.5) preferentially hydrolyzes inosine 5-prime-monophosphate (IMP) and other purine nucleotides, and is allosterically activated by various compounds, including ATP. The enzyme is exclusively located in the cytoplasmic matrix of cells and may have a critical role in the maintenance of a constant composition of intracellular purine/pyrimidine nucleotides in cooperation with other nucleotidases.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-GMP antibody, anti-NT5B antibody, anti-PNT5 antibody, anti-cN-II antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |