| request information: |
|
| Catalog Code: | H00022955-M01 |
| Product Name: | SCMH1 Antibody |
| Product Description: | Mouse Monoclonal anti-SCMH1 (2D7) |
| Clone: | 2D7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 22955 |
| Gene Symbol: | SCMH1 |
| Immunogen: | SCMH1 (NP_036368, 404 a.a. ~ 503 a.a) partial recombinant protein with GST tag. |
| Epitope: | EKLCHNLRSDNLFGNQPFTQTHLSLTAIEYSHSHDRYLPGET FVLGNSLARSLEPHSDSMDSASNPTNLVSTSQRHRPLLSSCG LPPSTASAVRRLCSR* |
| Specificity: | SCMH1 - sex comb on midleg homolog 1 (Drosophila) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Nuclear |
| Background: | Polycomb group genes are essential for maintenance of appropriate expression patterns of developmental master regulators, such as Hox genes, and thus are essential for proper development. SCMH1 (Sex comb on midleg homolog 1) is a constituent of the Polycomb group (PcG) multiprotein PRC1 complex. The PcG PRC1 complex acts via chromatin remodeling and modification of histones. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Polycomb protein SCMH1 antibody, anti-SCMH 1 antibody, anti-Scml 3 antibody, anti-Scml3 antibody, anti-Sex comb on midleg 1 antibody, anti-Sex comb on midleg homolog 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |