| request information: |
|
| Catalog Code: | H00022933-M01 |
| Product Name: | SIRT2 Antibody |
| Product Description: | Mouse Monoclonal anti-SIRT2 (4B11) |
| Clone: | 4B11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 22933 |
| Gene Symbol: | SIRT2 |
| Omim ID: | 604480 |
| Immunogen: | SIRT2 (AAH03012, 128 a.a. ~ 227 a.a) partial recombinant protein with GST tag. |
| Epitope: | YTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPL SWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQ SDFLKVDLLLVMGTSL |
| Specificity: | SIRT2 - sirtuin (silent mating type information regulation 2 homolog) 2 (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Cytoplasmic for short periods of time until complexes are formed (Sir2, Sir3 and Sir4). The complexes are recruited to their chromosome targets (nuclear) via interactions with DNA binding proteins, followed by deacetylation of histones H3 and H4. Therefore, this SIR2 / SIRT2 should be easily detectable in the nuclei and nuclear extracts. |
| Background: | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two transcript variants result from alternative splicing of this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SIR2 / SIRT2 antibody, anti-NAD dependent deacetylase sirtuin 2 antibody, anti-Silencing information regulator 2 like antibody, anti-Silent mating type information regulation 2 antibody, anti-Silent mating type information regulation 2 homolog antibody, anti-SIR 2 antibody, anti-SIR2 like antibody, anti-SIR2 like protein 2 antibody, anti-Sir2 related protein type 2 antibody, anti-SIR2L antibody, anti-SIR2L2 antibody, anti-SIRT 2 antibody, anti-Sirtuin 2 antibody, anti-Sirtuin type 2 antibody, anti-Sirtuin2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |