| Catalog Code: | H00022933-B01 |
| Product Type: | Primary Antibody |
| Product Name: | SIRT2 Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 22933 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-SIRT2 - sirtuin (silent mating type information regulation 2 homolog) 2 (S. cerevisiae), MaxPab Antibody |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det |
| Alternate Names: | anti-SIR2L antibody, anti-SIR2L2 antibody |
| Immunogen: | SIRT2 (NP_085096, 1 a.a. ~ 352 a.a) full-length human protein. |
| Epitope: | MDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQ ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |