ExactAntigen

SIRT2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00022933-B01
Product Type:Primary Antibody
Product Name:SIRT2 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:22933
Host:Mouse
Product Description:Mouse Polyclonal anti-SIRT2 - sirtuin (silent mating type information regulation 2 homolog) 2 (S. cerevisiae), MaxPab Antibody
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det
Alternate Names:anti-SIR2L antibody, anti-SIR2L2 antibody
Immunogen:SIRT2 (NP_085096, 1 a.a. ~ 352 a.a) full-length human protein.
Epitope:MDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQ ...
Preservative:No Preservative
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
see all human SIRT2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about