| request information: |
|
| Catalog Code: | H00022853-M02 |
| Product Name: | LMTK2 Antibody |
| Product Description: | Mouse Monoclonal anti-LMTK2 (3G1) |
| Clone: | 3G1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 22853 |
| Gene Symbol: | LMTK2 |
| Immunogen: | LMTK2 (NP_055731, 1181 a.a. ~ 1280 a.a) partial recombinant protein with GST tag. |
| Epitope: | EPAQTGVPQQVHPTEDEASSPWSVLNAELSSGDDFETQDDRPCTLASTGTNTNELLAYTNSALDKSLSSHSEGPKLKEP
DIEGKYLGKLGVSGMLDLSED |
| Specificity: | LMTK2 - lemur tyrosine kinase 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-KIAA1079 antibody, anti-KPI-2 antibody, anti-KPI2 antibody, anti-LMR2 antibody, anti-cprk antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |