ExactAntigen

NLGN4Y Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00022829-B01
Product Type:Primary Antibody
Product Name:NLGN4Y Antibody
List Price:295
Clonality:Polyclonal
Gene ID:22829
Host:Mouse
Product Description:Mouse Polyclonal anti-NLGN4Y - neuroligin 4, Y-linked, MaxPab Antibody
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:Neuroligins, such as NLGN4Y, are cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses (Jamain et al., 2003 [PubMed 12669065]).[supplied by OMIM]
Alternate Names:anti-KIAA0951 antibody
Immunogen:NLGN4Y (-, 1 a.a. ~ 134 a.a) full-length human protein.
Epitope:MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF ...
Preservative:No Preservative
Packaging:0.05 ml of mouse antisera with 50% glycerol.
PackageSize:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Application Summary:Western Blot 1:500, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human NLGN4Y antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about