ExactAntigen

Mouse Monoclonal anti-ZNFN1A3 (1D7)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00022806-M02
ProductName:ZNFN1A3 Antibody
Product Description:Mouse Monoclonal anti-ZNFN1A3 (1D7)
Clone:1D7
Clonality:Monoclonal
Immunogen:ZNFN1A3 (AAH32707, 1 a.a. ~ 510 a.a) full length recombinant protein with GST tag.
Epitope:MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQSTDPGDTASAEARHIKAEMGSERALV ...
Specificity:ZNFN1A3 - zinc finger protein, subfamily 1A, 3 (Aiolos)
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. At least six alternative transcripts encoding different isoforms have been described.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-AIOLOS antibody
ProteinTarget:ZNFN1A3 - zinc finger protein, subfamily 1A, 3 (Aiolos)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:22806
Gene_Symbol:ZNFN1A3
Omim_ID:606221 H00022806-M01
see all human IKZF3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about