| request information: |
|
| Catalog Code: | H00022801-A01 |
| Product Name: | ITGA11 Antibody |
| Product Description: | Mouse Polyclonal anti-ITGA11 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 22801 |
| Gene Symbol: | ITGA11 |
| Omim ID: | 604789 |
| Immunogen: | ITGA11 (NP_001004439, 793 a.a. ~ 894 a.a) partial recombinant protein with GST tag. |
| Epitope: | LDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAVEATLENRGENAYSTVLNISQSANLQFASLIQ
KEDSDGSIECVNEERRLQKQVC* |
| Specificity: | ITGA11 - integrin, alpha 11 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein contains an I domain, is expressed in muscle tissue, dimerizes with beta 1 integrin in vitro, and appears to bind collagen in this form. Therefore, the protein may be involved in attaching muscle tissue to the extracellular matrix. Alternative transcriptional splice variants have been found for this gene, but their biological validity is not determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-HsT18964 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |