| request information: | |
| Catalog Code: | H00022796-M09 |
| Product Name: | COG2 Antibody |
| Product Description: | Mouse Monoclonal anti-COG2 (4C8) |
| Clone: | 4C8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 22796 |
| Gene Symbol: | COG2 |
| Omim ID: | 606974, |
| Immunogen: | COG2 (NP_031383, 639 a.a. ~ 739 a.a) partial recombinant protein with GST tag. |
| Epitope: | LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIK SFSALAELVAAAKDQATAEQP* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG2 (Ungar et al., 2002 [PubMed 11980916]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-LDLC antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |