| request information: |
|
| Catalog Code: | H00022796-A01 |
| Product Name: | COG2 Antibody |
| Product Description: | Mouse Polyclonal anti-COG2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 22796 |
| Gene Symbol: | COG2 |
| Omim ID: | 606974, |
| Immunogen: | COG2 (NP_031383, 639 a.a. ~ 739 a.a) partial recombinant protein with GST tag. |
| Epitope: | LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIK
SFSALAELVAAAKDQATAEQP* |
| Specificity: | COG2 - component of oligomeric golgi complex 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG2 (Ungar et al., 2002 [PubMed 11980916]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-LDLC antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |