ExactAntigen

PTK9L Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00011344-M01
Product Type:Primary Antibody
Product Name:PTK9L Antibody
List Price:275
Clonality:Monoclonal
Gene ID:11344
Host:Mouse
Clone:2B5
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-PTK9L (2B5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = PTK9L PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-A6RP antibody, anti-A6r antibody, anti-MSTP011 antibody
Immunogen:PTK9L (AAH00327, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag.
Epitope:FAGYQKHLSSCAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAFPLQPEAQRALQQLKQKMVNYIQMKLDLERETIELVHTEPTDVAQLPSRVP ...
Specificity:PTK9L - PTK9L protein tyrosine kinase 9-like (A6-related protein)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PTK9L
Omim ID:607433,
see all human A6 related protein antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about