| request information: |
|
| Catalog Code: | H00011329-M11 |
| Product Name: | STK38 Antibody |
| Product Description: | Mouse Monoclonal anti-STK38 (2F6) |
| Clone: | 2F6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 11329 |
| Gene Symbol: | STK38 |
| Omim ID: | 606964, |
| Immunogen: | STK38 (AAH12085, 365 a.a. ~ 466 a.a) partial recombinant protein with GST tag. |
| Epitope: | EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINY
TYKRFEGLTARGAIPSYMKAAK* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-NDR antibody, anti-NDR1 antibody |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |