| request information: | |
| Catalog Code: | H00011329-M04 |
| Product Name: | STK38 Antibody |
| Product Description: | Mouse Monoclonal anti-STK38 (2F3) |
| Clone: | 2F3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 11329 |
| Gene Symbol: | STK38 |
| Omim ID: | 606964, |
| Immunogen: | STK38 (AAH12085, 365 a.a. ~ 466 a.a) partial recombinant protein with GST tag. |
| Epitope: | EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINY TYKRFEGLTARGAIPSYMKAAK* |
| Specificity: | STK38 - serine/threonine kinase 38 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
| Localization: | Cytoplasmic and Nuclear |
| Background: | STK38 belongs to the NDR family of serine/threonine protein kinases. NDR kinases require the phosphorylation of conserved Ser/Thr residues for activation. NDR family members have two unique stretches of primary sequence: an N-terminal regulatory (NTR) domain and an insert of several residues between subdomains VII and VIII of the kinase domain. The kinase domain insert functions as an auto-inhibitory sequence (AIS), while binding of the co-activator MOB (Mps-one binder) proteins to the NTR domain releases NDR kinases from inhibition of autophosphorylation. STK38 negatively regulates the activation of MEKK1/2 by direct interaction with the catalytic domain of MEKK1/2. The negative regulation of MEKK1/2 is not due to its phosphorylation by STK38. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot, RNAi Validation |
| Species Summary: | Hu |
| Alternate Names: | anti-NDR 1 antibody, anti-NDR1 antibody, anti-NDR1 protein kinase antibody, anti-Nuclear Dbf2 related kinase 1 antibody, anti-Serine/threonine protein kinase 38 antibody, anti-STK 38 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |