ExactAntigen

STK38 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00011329-M04
Product Name:STK38 Antibody
Product Description:Mouse Monoclonal anti-STK38 (2F3)
Clone:2F3
Clonality:Monoclonal
ListPrice:295
Gene ID:11329
Gene Symbol:STK38
Omim ID:606964,
Immunogen:STK38 (AAH12085, 365 a.a. ~ 466 a.a) partial recombinant protein with GST tag.
Epitope:EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINY
TYKRFEGLTARGAIPSYMKAAK*
Specificity:STK38 - serine/threonine kinase 38
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA.
Localization:Cytoplasmic and Nuclear
Background:STK38 belongs to the NDR family of serine/threonine protein kinases. NDR kinases require the phosphorylation of conserved Ser/Thr residues for activation. NDR family members have two unique stretches of primary sequence: an N-terminal regulatory (NTR) domain and an insert of several residues between subdomains VII and VIII of the kinase domain. The kinase domain insert functions as an auto-inhibitory sequence (AIS), while binding of the co-activator MOB (Mps-one binder) proteins to the NTR domain releases NDR kinases from inhibition of autophosphorylation. STK38 negatively regulates the activation of MEKK1/2 by direct interaction with the catalytic domain of MEKK1/2. The negative regulation of MEKK1/2 is not due to its phosphorylation by STK38.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Buffer:Phosphate buffered saline, pH 7.2
Application Summary:ELISA, Western Blot, RNAi Validation
Species Summary:Hu
Alternate Names:anti-NDR 1 antibody, anti-NDR1 antibody, anti-NDR1 protein kinase antibody, anti-Nuclear Dbf2 related kinase 1 antibody, anti-Serine/threonine protein kinase 38 antibody, anti-STK 38 antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human STK38 antibodies


2008©ExactAntigen home | browse | about