| request information: |
|
| Catalog Code: | H00011316-A01 |
| Product Name: | COPE Antibody |
| Product Description: | Mouse Polyclonal anti-COPE |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11316 |
| Gene Symbol: | COPE |
| Omim ID: | 606942 |
| Immunogen: | COPE (NP_009194, 211 a.a. ~ 309 a.a) partial recombinant protein with GST tag. |
| Epitope: | KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKE
YQAKENDFDRLVLQYAPSA* |
| Specificity: | COPE - coatomer protein complex, subunit epsilon |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles. It is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Coatomer complex consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FLJ13241 antibody, anti-epsilon-COP antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
| Product References: | 1. Styers ML, O'Connor AK, Grabski R, Cormet-Boyaka E, Sztul E Phd. Depletion of {beta}-COP reveals a role for COP-I in compartmentalization of secretory compartments and in biosynthetic transport of Caveolin-1. Am J Physiol Cell Physiol. 2008 Apr 2 |
order or
more information: | company product webpage |