| request information: |
|
| Catalog Code: | H00011314-B02 |
| Product Name: | CD300A Antibody |
| Product Description: | Mouse Polyclonal anti-CD300A - CD300A antigen, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 11314 |
| Gene Symbol: | CD300A |
| Immunogen: | CD300A (1 a.a. ~ 299 a.a) full-length human protein. |
| Epitope: | MWLPWALLLLWVPGCFALSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRD
SPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFA
VGATHSASIQEETEEVVNSQLPLLLSLLALLLLLLVGASLLAWRMFQKWIKAGDHSELSQNPKQAATQSELHYANLELL
MWPLQEKPAPPREVEVEY |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Background: | The CMRF35 antigen (CMRF35A; MIM 606786), which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes. CMRF35H is recognized by the same antibody and is distinct from CMRF35 (Green et al., 1998 [PubMed 9701027]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-CMRF-35-H9 antibody, anti-CMRF-35H antibody, anti-CMRF35H antibody, anti-CMRF35H9 antibody, anti-IGSF12 antibody, anti-IRC1 antibody, anti-IRC2 antibody, anti-IRp60 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |