| request information: |
|
| Catalog Code: | H00011285-B01 |
| Product Name: | B4GALT7 Antibody |
| Product Description: | Mouse Polyclonal anti-B4GALT7 - xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 (galactosyltransferase I), MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 11285 |
| Gene Symbol: | B4GALT7 |
| Omim ID: | 130070 |
| Immunogen: | B4GALT7 (1 a.a. ~ 327 a.a) full-length human protein. |
| Epitope: | MFPSRRKAAQLPWEDGRSGLLSGGLPRKCSVFHLFVACLSLGFFSLLWLQLSCSGDVARAVRGQGQETSGPPRACPPEP
PPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDY
IAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVGGILLLSKQHYRLCNGMSNRFWGWGREDDEFYRRIKG
AGLQLFRPSGITTGYKTF |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Background: | This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene attaches the first galactose in the common carbohydrate-protein (GlcA-beta1,3-Gal-beta1,3-Gal-beta1,4-Xyl-beta1-O-Ser) linkage found in proteoglycans. Manganese is required as a cofactor. This enzyme differs from the other six beta4GalTs because it lacks the conserved beta4GalT1-beta4GalT6 Cys residues and it is located in cis-Golgi instead of trans-Golgi. Two single-nucleotide mutations were identified from a patient with the progeroid type of Ehlers-Danlos syndrome. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-B4GAL-T7 antibody, anti-XGALT-1 antibody, anti-XGALT1 antibody, anti-XGPT1 antibody, anti-beta4Gal-T7 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |
|