| request information: |
|
| Catalog Code: | H00011281-M08 |
| Product Name: | POU6F2 Antibody |
| Product Description: | Mouse Monoclonal anti-POU6F2 (8F9) |
| Clone: | 8F9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 11281 |
| Gene Symbol: | POU6F2 |
| Omim ID: | 601583, 609062, |
| Immunogen: | POU6F2 (NP_009183, 2 a.a. ~ 88 a.a) partial recombinant protein with GST tag. |
| Epitope: | IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPP
FPVGPQP* |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways (see review by Phillips and Luisi, 2000 [PubMed 11183772]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | protein A purified |
| Host Name: | Mouse |
| Buffer: | 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-RPF-1 antibody, anti-WT5 antibody, anti-WTSL antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|