| request information: | |
| Catalog Code: | H00011281-A01 |
| Product Name: | POU6F2 Antibody |
| Product Description: | Mouse Polyclonal anti-POU6F2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11281 |
| Gene Symbol: | POU6F2 |
| Omim ID: | 601583 609062 |
| Immunogen: | POU6F2 (NP_009183, 2 a.a. ~ 88 a.a) partial recombinant protein with GST tag. |
| Epitope: | IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPP FPVGPQP* |
| Specificity: | POU6F2 - POU domain, class 6, transcription factor 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways (see review by Phillips and Luisi, 2000 [PubMed 11183772]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-RPF-1 antibody, anti-WT5 antibody, anti-WTSL antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or more information: | company product webpage |