| request information: |
|
| Catalog Code: | H00011278-A01 |
| Product Name: | KLF12 Antibody |
| Product Description: | Mouse Polyclonal anti-KLF12 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11278 |
| Gene Symbol: | KLF12 |
| Omim ID: | 607531 |
| Immunogen: | KLF12 (NP_009180, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. |
| Epitope: | MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQT
EPVDLSINKAR* |
| Specificity: | KLF12 - Kruppel-like factor 12 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1. Two transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AP-2rep antibody, anti-AP2REP antibody, anti-HSPC122 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |