| request information: |
|
| Catalog Code: | H00011267-A01 |
| Product Name: | EAP30 Antibody |
| Product Description: | Mouse Polyclonal anti-EAP30 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11267 |
| Gene Symbol: | SNF8 |
| Immunogen: | EAP30 (NP_009172, 23 a.a. ~ 123 a.a) partial recombinant protein with GST tag. |
| Epitope: | ERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELG
VQIIEVCLALKHRNGGLITLE* |
| Specificity: | SNF8 - EAP30 subunit of ELL complex |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |