| request information: |
|
| Catalog Code: | H00011255-A01 |
| Product Name: | HRH3 Antibody |
| Product Description: | Mouse Polyclonal anti-HRH3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11255 |
| Gene Symbol: | HRH3 |
| Omim ID: | 604525 |
| Immunogen: | HRH3 (NP_009163, 257 a.a. ~ 360 a.a) partial recombinant protein with GST tag. |
| Epitope: | GCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEK
RMKMVSQSFTQRFRLSRDRKVAKS* |
| Specificity: | HRH3 - histamine receptor H3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. Histamine receptor H3 belongs to the family 1 of G protein-coupled receptors. It is an integral membrane protein and can regulate neurotransmitter release. This receptor can also increase voltage-dependent calcium current in smooth muscles and innervates the blood vessels and the heart in cardiovascular system. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GPCR97 antibody, anti-HH3R antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |