| request information: |
|
| Catalog Code: | H00011232-B01 |
| Product Name: | POLG2 Antibody |
| Product Description: | Mouse Polyclonal anti-POLG2 - polymerase (DNA directed), gamma 2, accessory subunit, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 11232 |
| Gene Symbol: | POLG2 |
| Immunogen: | POLG2 (AAH09194, 1 a.a. ~ 485 a.a) full-length human protein. |
| Epitope: | MRSRVAVRACHKVCRCLLSGFGGRVDAGQPELLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFL
SGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQ
DKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEA
SLVWFTPPRTSNQWLDFW |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | The accuracy of mitochondrial DNA (mtDNA) replication depends on the coordinated action of many nuclear-encoded proteins and on the correct balance of nucleotides within the mitochondrial matrix. mtDNA is replicated by DNA polymerase gamma, which is composed of a 140-kD catalytic subunit (POLG1; MIM 174763) and a 55-kD accessory subunit (POLG2).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-HP55 antibody, anti-MTPOLB antibody, anti-POLB antibody, anti-POLGB antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |