| request information: | |
| Catalog Code: | H00011221-A01 |
| Product Name: | DUSP10 Antibody |
| Product Description: | Mouse Polyclonal anti-DUSP10 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11221 |
| Gene Symbol: | DUSP10 |
| Omim ID: | 608867 |
| Immunogen: | DUSP10 (AAH20608, 1 a.a. ~ 141 a.a) full length recombinant protein with GST tag. |
| Epitope: | MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIA YLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV* |
| Specificity: | DUSP10 - dual specificity phosphatase 10 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the MAPK superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of this family of dual specificity phosphatases show distinct substrate specificities for MAPKs, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product binds to and inactivates p38 and SAPK/JNK, but not MAPK/ERK. Its subcellular localization is unique; it is evenly distributed in both the cytoplasm and the nucleus. This gene is widely expressed in various tissues and organs, and its expression is elevated by stress stimuli. Three transcript variants encoding two different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MKP-5 antibody, anti-MKP5 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or more information: | company product webpage |