ExactAntigen

DDX20 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00011218-M01
Product Type:Primary Antibody
Product Name:DDX20 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:11218
Host:Mouse
Clone:5H5
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-DDX20 (5H5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = DDX20 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-DDX20 antibody, anti-DDX-20 antibody, anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 20 antibody, anti-DEAD-box Protein DP103 antibody, anti-SMN-interacting Protein antibody, anti-DKFZp434H052 antibody, anti-DP103 antibody, anti-GEMIN3 antibody
Immunogen:DDX20 (NP_009135, 725 a.a. ~ 825 a.a) partial recombinant protein with GST tag.
Epitope:EGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ* ...
Specificity:DDX20 - DEAD (Asp-Glu-Ala-Asp) box polypeptide 20
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:DDX20
Omim ID:606168,
see all human DDX20 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about