| CatalogCode: | H00011202-M01 |
| ProductName: | KLK8 Antibody |
| Product Description: | Mouse Monoclonal anti-KLK8 (2F11) |
| Clone: | 2F11 |
| Clonality: | Monoclonal |
| Immunogen: | KLK8 (NP_009127, 97 a.a. ~ 205 a.a) partial recombinant protein with GST tag. |
| Epitope: | EIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKG* ... |
| Specificity: | KLK8 - kallikrein 8 (neuropsin/ovasin) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-HNP antibody, anti-NP antibody, anti-NRPN antibody, anti-PRSS19 antibody, anti-TADG14 antibody |
| ProteinTarget: | KLK8 - kallikrein 8 (neuropsin/ovasin) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 11202 |
| Gene_Symbol: | KLK8 |
| Omim_ID: | 605644, |
order or
more information: | company product webpage |
| request information: |
|