| request information: |
|
| Catalog Code: | H00011202-A01 |
| Product Name: | KLK8 Antibody |
| Product Description: | Mouse Polyclonal anti-KLK8 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11202 |
| Gene Symbol: | KLK8 |
| Omim ID: | 605644, |
| Immunogen: | KLK8 (NP_009127, 97 a.a. ~ 205 a.a) partial recombinant protein with GST tag. |
| Epitope: | EIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAE
VKIFPQKKCEDAYPGQITDGMVCAGSSKG* |
| Specificity: | KLK8 - kallikrein 8 (neuropsin/ovasin) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-HNP antibody, anti-NP antibody, anti-NRPN antibody, anti-PRSS19 antibody, anti-TADG14 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |