ExactAntigen

SUPT16H Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00011198-M07
Product Name:SUPT16H Antibody
Product Description:Mouse Monoclonal anti-SUPT16H (4D6)
Clone:4D6
Clonality:Monoclonal
ListPrice:295
Gene ID:11198
Gene Symbol:SUPT16H
Omim ID:605012,
Immunogen:SUPT16H (NP_009123, 608 a.a. ~ 716 a.a) partial recombinant protein with GST tag.
Epitope:PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNG
FRFTSVRGDKVDILYNNIKHALFQPCDGE*
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against recombinant protein on ELISA.
Background:Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit, the latter of which is the protein encoded by this gene.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Buffer:In 1x PBS, pH 7.2
Application Summary:ELISA
Species Summary:Hu
Alternate Names:anti-CDC68 antibody, anti-FACT antibody, anti-FACTP140 antibody, anti-FLJ10857 antibody, anti-FLJ14010 antibody, anti-SPT16/CDC68 antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human SUPT16H antibodies


2008©ExactAntigen home | browse | about