| CatalogCode: | H00011198-M05 |
| ProductName: | suppressor of Ty 16 homolog Antibody |
| Product Description: | Mouse Monoclonal anti-suppressor of Ty 16 homolog (3G9) |
| Clone: | 3G9 |
| Clonality: | Monoclonal |
| Immunogen: | SUPT16H (NP_009123, 608 a.a. ~ 716 a.a) partial recombinant protein with GST tag. |
| Epitope: | PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE* ... |
| Specificity: | suppressor of Ty 16 homolog (S. cerevisiae) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit, the latter of which is the protein encoded by this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CDC68 antibody, anti-FACT antibody, anti-FACTP140 antibody, anti-FLJ10857 antibody, anti-FLJ14010 antibody, anti-SPT16/CDC68 antibody |
| ProteinTarget: | suppressor of Ty 16 homolog (S. cerevisiae) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 11198 |
| Gene_Symbol: | SUPT16H |
| Omim_ID: | 605012, |
order or more information: | company product webpage |
| request information: | |