| request information: |
|
| Catalog Code: | H00011198-M01 |
| Product Name: | suppressor of Ty 16 homolog Antibody |
| Product Description: | Mouse Monoclonal anti-suppressor of Ty 16 homolog (1D12) |
| Clone: | 1D12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 11198 |
| Gene Symbol: | SUPT16H |
| Omim ID: | 605012, |
| Immunogen: | SUPT16H (NP_009123, 608 a.a. ~ 716 a.a) partial recombinant protein with GST tag. |
| Epitope: | PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNG
FRFTSVRGDKVDILYNNIKHALFQPCDGE* |
| Specificity: | suppressor of Ty 16 homolog (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit, the latter of which is the protein encoded by this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CDC68 antibody, anti-FACT antibody, anti-FACTP140 antibody, anti-FLJ10857 antibody, anti-FLJ14010 antibody, anti-SPT16/CDC68 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |