ExactAntigen

WIF1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00011197-B01
Product Type:Primary Antibody
Product Name:WIF1 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:11197
Host:Mouse
Product Description:Mouse Polyclonal anti-WIF1 - WNT inhibitory factor 1, MaxPab Antibody
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:WNT proteins are extracellular signaling molecules involved in the control of embryonic development. This gene encodes a secreted protein, which binds WNT proteins and inhibits their activities. This protein contains a WNT inhibitory factor (WIF) domain a
Alternate Names:anti-WIF-1 antibody
Immunogen:WIF1 (AAH18037, 1 a.a. ~ 379 a.a) full-length human protein.
Epitope:MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGT ...
Preservative:No Preservative
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
see all human WIF1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about