| request information: |
|
| Catalog Code: | H00011187-A01 |
| Product Name: | PKP3 Antibody |
| Product Description: | Mouse Polyclonal anti-PKP3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11187 |
| Gene Symbol: | PKP3 |
| Omim ID: | 605561 |
| Immunogen: | PKP3 (NP_009114, 225 a.a. ~ 325 a.a) partial recombinant protein with GST tag. |
| Epitope: | RAGGLDWPEATEVSPSRTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPSVRSLSLSLADSGHLPDVHGFNSY
GSHRTLQRLSSGFDDIDLPSA* |
| Specificity: | PKP3 - plakophilin 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the arm-repeat (armadillo) and plakophilin gene families. Plakophilin proteins contain numerous armadillo repeats, localize to cell desmosomes and nuclei, and participate in linking cadherins to intermediate filaments in the cytoskeleton. This protein may act in cellular desmosome-dependent adhesion and signaling pathways. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |