| CatalogCode: | H00011180-M01 |
| ProductName: | WDR6 Antibody |
| Product Description: | Mouse Monoclonal anti-WDR6 (2D4) |
| Clone: | 2D4 |
| Clonality: | Monoclonal |
| Immunogen: | WDR6 (AAH02826, 1 a.a. ~ 290 a.a) full length recombinant protein with GST tag. |
| Epitope: | MHLSSHRLDEYWDRQRNRHRMVKVDPETRYMSLAVCELDQPGLGPLVAAACSDGAVRLFLLQDSGRILQLLAETFHHKRCVLKVHSFTHEAPNQRRRLLLCSAATDGSLAFWDLTTMLDHDSTVLEPPVDPGLPYRLGTPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLEEAVGEAGLVPQLRVLEEYSVPCAHAAHVTGLKILSPSIMVSASIDQRLTFWRLGHGEPTFMNSTVFH ... |
| Specificity: | WDR6 - WD repeat domain 6 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is ubiquitously expressed in adult and fetal tissues. |
| ProductRef: | Identification and characterization of an insulin receptor substrate 4-interacting protein in rat brain:Implications for longevity.Chiba T, Shimokawa I. et al. Neurobiol Aging. 2007 Aug 24; [Epub ahead of print] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a lambda |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-FLJ10218 antibody |
| ProteinTarget: | WDR6 - WD repeat domain 6 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 11180 |
| Gene_Symbol: | WDR6 |
| Omim_ID: | 606031 H00080349-A01 |