| request information: |
|
| Catalog Code: | H00011180-A01 |
| Product Name: | WDR6 Antibody |
| Product Description: | Mouse Polyclonal anti-WDR6 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11180 |
| Gene Symbol: | WDR6 |
| Omim ID: | 606031, |
| Immunogen: | WDR6 (NP_060501, 1022 a.a. ~ 1122 a.a) partial recombinant protein with GST tag. |
| Epitope: | AVGEAGLVPQLRVLEEYSVPCAHAAHVTGLKILSPSIMVSASIDQRLTFWRLGHGEPTFMNSTVFHVPDVADMDCWPVS
PEFGHRCALGGQGLEVYNWYD* |
| Specificity: | WDR6 - WD repeat domain 6 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is ubiquitously expressed in adult and fetal tissues. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FLJ10218 antibody, anti-MGC126756 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |