| request information: |
|
| Catalog Code: | H00011178-A01 |
| Product Name: | LZTS1 Antibody |
| Product Description: | Mouse Polyclonal anti-LZTS1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11178 |
| Gene Symbol: | LZTS1 |
| Omim ID: | 133239 606551 |
| Immunogen: | LZTS1 (NP_066300, 514 a.a. ~ 597 a.a) partial recombinant protein with GST tag. |
| Epitope: | ERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDII
ATEI* |
| Specificity: | LZTS1 - leucine zipper, putative tumor suppressor 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-F37 antibody, anti-FEZ1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |