| request information: |
|
| Catalog Code: | H00011162-B01 |
| Product Name: | NUDT6 Antibody |
| Product Description: | Mouse Polyclonal anti-NUDT6 - nudix (nucleoside diphosphate linked moiety X)-type motif 6, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 11162 |
| Gene Symbol: | NUDT6 |
| Immunogen: | NUDT6 (1 a.a. ~ 316 a.a) full-length human protein. |
| Epitope: | MRQPLSWGRWRAMLARTYGPGPSAGYRWASGAQGYVRNPPVGACDLQGELDRFGGISVRLARLDALDRLDAAAFQKGLQ
AAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDSSTLTLWLREGPSRLPGYASHQVGVAGAVFDESTRKI
LVVQDRNKLKNMWKFPGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQQHTNPGAFGKSDMYIICRLKPYSFTIN
FCQEECLRCEWMDLNDLA |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Background: | FGF2 (MIM 134920) is a highly conserved, multifunctional heparin-binding growth factor involved in neuroectoderm development, angiogenesis, and wound healing. Elevated levels of FGF2 are associated with proliferation of smooth muscle in atherosclerosis and with proliferation of tumors. The FGF2 antisense gene, NUDT6, may regulate FGF2 expression.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-ASFGF2 antibody, anti-FGF-2 antibody, anti-FGF-AS antibody, anti-FGF2AS antibody, anti-bFGF antibody, anti-gfg antibody, anti-gfg-1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |