| request information: |
|
| Catalog Code: | H00011156-A01 |
| Product Name: | PTP4A3 Antibody |
| Product Description: | Mouse Polyclonal anti-PTP4A3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11156 |
| Gene Symbol: | PTP4A3 |
| Omim ID: | 606449 |
| Immunogen: | PTP4A3 (AAH03105, 1 a.a. ~ 149 a.a) full length recombinant protein with GST tag. |
| Epitope: | MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGK
VVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM* |
| Specificity: | PTP4A3 - protein tyrosine phosphatase type IVA, member 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene belongs to a small class of prenylated protein tyrosine phosphatases (PTPs). PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. This class of PTPs contain a PTP domain and a characteristic C-terminal prenylation motif. Studies of this class of PTPs in mice demonstrated that they were prenylated proteins in vivo, which suggested their association with cell plasma membrane. Overexpression of this gene in mammalian cells was reported to inhibit angiotensin-II induced cell calcium mobilization and promote cell growth. Two alternatively spliced variants exist. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Potentially prenylated protein tyrosine phosphatase antibody, anti-PRL3 antibody, anti-PRLR antibody, anti-Protein tyrosine phosphatase 4a3 antibody, anti-Protein tyrosine phosphatase of regenerating liver 3 antibody, anti-Protein tyrosine phosphatase type IVA member 3 antibody, anti-Protein tyrosine phosphatase type IVA protein 3 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |