| request information: |
|
| Catalog Code: | H00011145-B01 |
| Product Name: | HRASLS3 Antibody |
| Product Description: | Mouse Polyclonal anti-HRASLS3 - HRAS-like suppressor 3, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 11145 |
| Gene Symbol: | HRASLS3 |
| Immunogen: | HRASLS3 (AAH01387, 1 a.a. ~ 162 a.a) full-length human protein. |
| Epitope: | MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNK
HDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNK
RQKQ |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-H-REV107-1 antibody, anti-HREV107 antibody, anti-HREV107-3 antibody, anti-MGC118754 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |