| request information: |
|
| Catalog Code: | H00011140-M01 |
| Product Name: | CDC37 Antibody |
| Product Description: | Mouse Monoclonal anti-CDC37 (3C7) |
| Clone: | 3C7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 11140 |
| Gene Symbol: | CDC37 |
| Omim ID: | 605065 |
| Immunogen: | CDC37 (AAH08793, 1 a.a. ~ 379 a.a) full length recombinant protein with GST tag. |
| Epitope: | MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQ FQKEKEELDRGCRECKRKVAECQRKLKELEVAEGGKAELERL QAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKDGFSK SMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRW DDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVA HQTIVMQFILELAKSLKVDPRACFRQFFTKIKTAD |
| Specificity: | CDC37 - CDC37 cell division cycle 37 homolog (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Localization: | Cytoplasmic and Nuclear |
| Background: | The protein encoded by this gene is highly similar to Cdc 37, a cell division cycle control protein of Sacchromyces cerevisiae. This protein is a molecular chaperone with specific function in cell signal transduction. It has been shown to form complex with Hsp90 and a variety of protein kinases including CDK4, CDK6, SRC, RAF-1, MOK, as well as eIF2 alpha kinases. It is thought to play a critical role in directing Hsp90 to its target kinases. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti- S cerevisiae hypothetical protein CDC37 antibody, anti-CDC 37 antibody, anti-CDC37 antibody, anti-CDC37 cell division cycle 37 homolog antibody, anti-Cdc37 homolog antibody, anti-CDC37 protein antibody, anti-Cell division cycle 37 homolog antibody, anti-Hsp90 chaperone protein kinase targeting subunit antibody, anti-Hsp90 chaperone protein kinase targeting subunit p50Cdc37 antibody, anti-Hsp90 co chaperone Cdc37 antibody, anti-p50 antibody, anti-p50Cdc37 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |