| request information: |
|
| Catalog Code: | H00011137-M01 |
| Product Name: | PWP1 Antibody |
| Product Description: | Mouse Monoclonal anti-PWP1 (3A11) |
| Clone: | 3A11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 11137 |
| Gene Symbol: | PWP1 |
| Immunogen: | PWP1 (AAH01652, 1 a.a. ~ 502 a.a) full length recombinant protein with GST tag. |
| Epitope: | MNRSRQVTCVAWVRCGVAKETPDKVELSKEEVKRLIAEAKEK LQEEGGGSDEEETGSPSEDGMQSARTQARPREPLEDGDPEDD RTLDDDELAEYDLDKYDEEGDPDAETLGESLLGLTVYGSNDQ DPYVTLKDTEQYEREDFLIKPSDNLIVCGRAEQDQCNLDVHV YNQEEDSFYVHHDILLSAYPLSVEWLNFDPSPDDSTGNYIAV GNMTPVIEVWDLDIVDSLEPVFTLGSKLSKKKKKK |
| Specificity: | PWP1 - PWP1 homolog (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Nuclear |
| Background: | PWP1 belongs to the WD repeat PWP1 family. It may play an important role in cell growth and/or transcription. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-IEF-SSP-9502 antibody, anti-Keratinocyte protein IEF SSP 9502 antibody, anti-Periodic tryptophan protein 1 homolog antibody, anti-PWP1 antibody, anti-PWP1 homolog antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |