| request information: |
|
| Catalog Code: | H00011135-A01 |
| Product Name: | CDC42EP1 Antibody |
| Product Description: | Mouse Polyclonal anti-CDC42EP1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11135 |
| Gene Symbol: | CDC42EP1 |
| Omim ID: | 606084 |
| Immunogen: | CDC42EP1 (AAH09356, 1 a.a. ~ 385 a.a) full length recombinant protein with GST tag. |
| Epitope: | MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPR
SFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLDS
GFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTAN
PTGPAANPPATTANPPAP |
| Specificity: | CDC42EP1 - CDC42 effector protein (Rho GTPase binding) 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-BORG5 antibody, anti-CEP1 antibody, anti-MGC15316 antibody, anti-MSE55 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |