| request information: |
|
| Catalog Code: | H00011124-A01 |
| Product Name: | FAF1 Antibody |
| Product Description: | Mouse Polyclonal anti-FAF1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11124 |
| Gene Symbol: | FAF1 |
| Omim ID: | 604460 |
| Immunogen: | FAF1 (NP_008982, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag. |
| Epitope: | EAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDP
NKSLLEVKLFPQETLFLEAKE* |
| Specificity: | FAF1 - Fas (TNFRSF6) associated factor 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | Interaction of Fas ligand (TNFSF6) with the FAS antigen (TNFRSF6) mediates programmed cell death, also called apoptosis, in a number of organ systems. The protein encoded by this gene binds to FAS antigen and can initiate apoptosis or enhance apoptosis initiated through FAS antigen. Initiation of apoptosis by the protein encoded by this gene requires a ubiquitin-like domain but not the FAS-binding domain. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CGI-03 antibody, anti-HFAF1s antibody, anti-hFAF1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |