| request information: |
|
| Catalog Code: | H00011101-A01 |
| Product Name: | ATE1 Antibody |
| Product Description: | Mouse Polyclonal anti-ATE1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11101 |
| Gene Symbol: | ATE1 |
| Omim ID: | 607103 |
| Immunogen: | ATE1 (NP_001001976, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRC
RPLQFQPS* |
| Specificity: | ATE1 - arginyltransferase 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FLJ20003 antibody, anti-MGC26724 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |