| request information: |
|
| Catalog Code: | H00011095-M01 |
| Product Name: | ADAMTS8 Antibody |
| Product Description: | Mouse Monoclonal anti-ADAMTS8 (5A3) |
| Clone: | 5A3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 11095 |
| Gene Symbol: | ADAMTS8 |
| Omim ID: | 605175, |
| Immunogen: | ADAMTS8 (NP_008968, 781 a.a. ~ 891 a.a) partial recombinant protein with GST tag. |
| Epitope: | RPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVLGDWSECSSTCGAGWQRRTVE
CRDPSGQASATCNKALKPEDAKPCESQLCPL* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene contains two C-terminal TS motifs, and disrupts angiogenesis in vivo. A number of disorders have been mapped in the vicinity of this gene, most notably lung neoplasms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ADAM-TS8 antibody, anti-METH2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |