| request information: |
|
| Catalog Code: | H00011085-A01 |
| Product Name: | ADAM30 Antibody |
| Product Description: | Mouse Polyclonal anti-ADAM30 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 11085 |
| Gene Symbol: | ADAM30 |
| Omim ID: | 604779 |
| Immunogen: | ADAM30 (NP_068566, 199 a.a. ~ 299 a.a) partial recombinant protein with GST tag. |
| Epitope: | YKHPKYLELILLFDQSRYRFVNNNLSQVIHDAILLTGIMDTYFQDVRMRIHLKALEVWTDFNKIRVGYPELAEVLGRFV
IYKKSVLNARLSSDWAHLYLQ* |
| Specificity: | ADAM30 - a disintegrin and metalloproteinase domain 30 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-svph4 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |