ExactAntigen

WWP2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00011060-B01
Product Type:Primary Antibody
Product Name:WWP2 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:11060
Host:Mouse
Product Description:Mouse Polyclonal anti-WWP2 - WW domain containing E3 ubiquitin protein ligase 2, MaxPab Antibody
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:This gene encodes a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. The encoded protein contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Alternate Names:anti-AIP2 antibody
Immunogen:WWP2 (-, 1 a.a. ~ 335 a.a) full-length human protein.
Epitope:MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTS ...
Preservative:No Preservative
Packaging:0.05 ml of mouse antisera with 50% glycerol.
PackageSize:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Application Summary:Western Blot 1:500, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human WWP2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about